KChIP2 Rabbit anti-Human, Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-10370-100UL

Product Code. 18363116

Description

KChIP2 Polyclonal specifically detects KChIP2 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry.

Specifications

• Antigen: KChIP2
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry
• Gene Alias: A-type potassium channel modulatory protein 2, cardiac voltage gated potassium channel modulatory subunit, Cardiac voltage-gated potassium channel modulatory subunit, DKFZp566L1246, KChIP2, KCHIP2Kv channel-interacting protein 2, Kv channel interacting protein 2, MGC17241, potassium channel interacting protein 2, Potassium channel-interacting protein 2
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KChIP2 (NP_775285). Peptide sequence QLTDSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYRGFKNPGALS
• Quantity: 100 μg
• Research Discipline: Vision
• Gene ID (Entrez): 30819
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Form: Purified