missing translation for 'onlineSavingsMsg'
Learn More
Learn More
KChIP2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-38383-100ul
This item is not returnable.
View return policy
Description
KChIP2 Polyclonal antibody specifically detects KChIP2 in Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| KChIP2 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA | |
| A-type potassium channel modulatory protein 2, cardiac voltage gated potassium channel modulatory subunit, Cardiac voltage-gated potassium channel modulatory subunit, DKFZp566L1246, KChIP2, KCHIP2Kv channel-interacting protein 2, Kv channel interacting protein 2, MGC17241, potassium channel interacting protein 2, Potassium channel-interacting protein 2 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human KChIP2 (NP_775284.1).,, Sequence:, MRGQGRKESLSDSRDLDGSYDQLTGHPPGPTKKALKQRFLKLLPCCGPQALPSVSENSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQ | |
| 100 μL | |
| Vision | |
| 30819 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction