KCC3/SLC12A6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Marca:  Novus Biologicals NBP1-89282

Codice prodotto. 18206677

Descrizione

KCC3/SLC12A6 Polyclonal specifically detects KCC3/SLC12A6 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifica

• Antigen: KCC3/SLC12A6
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: ACCPN, agenesis of corpus callosum and peripheral neuropathy (Andermann syndrome), DKFZp434D2135, EC 1.2.4.1, EC 6.1.1.3, Electroneutral potassium-chloride cotransporter 3, KCC3A, KCC3B, KCC3potassium chloride cotransporter 3, K-Cl cotransporter 3, potassium chloride cotransporter KCC3a-S3, potassium-chloride transporter-3a, potassium-chloride transporter-3b, solute carrier family 12 (potassium/chloride transporters), member 6, solute carrier family 12 member 6
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9990
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: SLC12A6
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:RVRFSSRESVPETSRSEPMSEMSGATTSLATVALDPPSDRTSHPQDVIEDLSQNSITGEHSQLLDDGHKKARNAYLNNSNYEEGDE
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only