missing translation for 'onlineSavingsMsg'
Learn More
Learn More
KBTBD10 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-80310
This item is not returnable.
View return policy
Description
KBTBD10 Polyclonal specifically detects KBTBD10 in Human samples. It is validated for Western Blot.
Specifications
| KBTBD10 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| FLJ60989, kelch repeat and BTB (POZ) domain containing 10, kelch repeat and BTB domain-containing protein 10, Kelch-related protein 1, Kel-like protein 23, KRP1, Sarcosin, SARCOSINsarcomeric muscle protein | |
| Rabbit | |
| 68 kDa | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Xenopus: 85%; Chicken: 78%. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
| Purified |
| Western Blot | |
| 1 mg/ml | |
| Western Blot 1.0 ug/ml | |
| NP_006054 | |
| KBTBD10 | |
| Synthetic peptide directed towards the C terminal of human KBTBD10. Peptide sequence AGSLYAIGGFAMIQLESKEFAPTEVNDIWKYEDDKKEWAGMLKEIRYASG. | |
| Protein A purified | |
| RUO | |
| 10324 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction