missing translation for 'onlineSavingsMsg'
Learn More
Learn More
katanin-p80 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£145.00 - £417.00
Specifications
| Antigen | katanin-p80 |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 |
| Applications | ELISA, Western Blot, Immunocytochemistry/Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30229752
|
Novus Biologicals
NBP3-37906-20ul |
20 μL |
£145.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30229623
|
Novus Biologicals
NBP3-37906-100ul |
100 μL |
£417.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
katanin-p80 Polyclonal antibody specifically detects katanin-p80 in Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ImmunofluorescenceSpecifications
| katanin-p80 | |
| ELISA, Western Blot, Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Stem Cell Markers | |
| PBS (pH 7.3), 50% glycerol | |
| 10300 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:1000, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Mouse, Rat | |
| KAT, katanin (80 kDa), katanin p80 (WD repeat containing) subunit B 1, katanin p80 (WD40-containing) subunit B 1, Katanin p80 subunit B1, katanin p80 WD40-containing subunit B1, p80 katanin | |
| A synthetic peptide corresponding to a sequence within amino acids 400-500 of human katanin-p80 (NP_005877.2).,, Sequence:, SEPFPAPPEDDAATAKEAAKPSPAMDVQFPVPNLEVLPRPPVVASTPAPKAEPAIIPATRNEPIGLKASDFLPAVKIPQQAELVDEDAMSQIRKGHDTMCV | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title