missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18406020

KAT6B-MORF Antibody, Novus Biologicals™

Codice prodotto. 18406020 Sfoglia Tutto Bio Techne Prodotti
Cambia vista
Click to view available options
Quantity:
100 μL
Dimensione della confezione:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantity unitSize
18406020 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
Codice prodotto. 18406020 Fornitore Novus Biologicals N. del fornitore NBP180324100ul

Please to purchase this item. Need a web account? Register with us today!

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Descrizione

Rabbit Polyclonal Antibody

KAT6B-MORF Polyclonal antibody specifically detects KAT6B-MORF in Human samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifica

Antigen KAT6B-MORF
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/mL
Conjugate Unconjugated
Dilution Western Blot 1.0 μg/mL
Formulation PBS, 2% Sucrose
Gene Accession No. AAH48199
Gene Alias DKFZp313G1618, FLJ90335, Histone acetyltransferase MORF, Histone acetyltransferase MOZ2, histone acetyltransferase MYST4, KAT6B, KIAA0383, Monocytic leukemia zinc finger protein-related factor, MORFMorf, MOZ, YBF2/SAS3, SAS2 and TIP60 protein 4, MOZ2EC 2.3.1.48, MOZ-related factor, MYST histone acetyltransferase (monocytic leukemia) 4, MYST-4, qkf, querkopf
Host Species Rabbit
Immunogen Synthetic peptide directed towards the N terminal of human MYST4. Peptide sequence MVKLANPLYTEWILEAIQKIKKQKQRPSEERICHAVSTSHGLDKKTVSEQ. The peptide sequence for this immunogen was taken from within the described region.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 23522
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Vedi altri risultati Mostra meno risultati
Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.