missing translation for 'onlineSavingsMsg'
Learn More

KAT6B-MORF Antibody, Novus Biologicals™

Product Code. 18406020 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18406020 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18406020 Supplier Novus Biologicals Supplier No. NBP180324100ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

KAT6B-MORF Polyclonal antibody specifically detects KAT6B-MORF in Human samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen KAT6B-MORF
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/mL
Conjugate Unconjugated
Dilution Western Blot 1.0 μg/mL
Formulation PBS, 2% Sucrose
Gene Accession No. AAH48199
Gene Alias DKFZp313G1618, FLJ90335, Histone acetyltransferase MORF, Histone acetyltransferase MOZ2, histone acetyltransferase MYST4, KAT6B, KIAA0383, Monocytic leukemia zinc finger protein-related factor, MORFMorf, MOZ, YBF2/SAS3, SAS2 and TIP60 protein 4, MOZ2EC 2.3.1.48, MOZ-related factor, MYST histone acetyltransferase (monocytic leukemia) 4, MYST-4, qkf, querkopf
Host Species Rabbit
Immunogen Synthetic peptide directed towards the N terminal of human MYST4. Peptide sequence MVKLANPLYTEWILEAIQKIKKQKQRPSEERICHAVSTSHGLDKKTVSEQ. The peptide sequence for this immunogen was taken from within the described region.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 23522
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.