missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Kanadaptin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-38315
This item is not returnable.
View return policy
Description
Kanadaptin Polyclonal specifically detects Kanadaptin in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| Kanadaptin | |
| Polyclonal | |
| Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Q9BWU0 | |
| SLC4A1AP | |
| This antibody was developed against a recombinant protein corresponding to amino acids: TWGMGEDAVEDDAEENPIVLEFQQEREAFYIKDPKKALQGFFDREGEELEYEFDEQGHSTWLCRVRLPVDDSTGKQLVAEAIHSGKK | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| FLJ10624, FLJ41004, HLC3, HLC-3, Human lung cancer oncogene 3 protein, kanadaptin, Kidney anion exchanger adapter protein, kidney anion exchanger adaptor protein, lung cancer oncogene 3, MGC120646, MGC120648, solute carrier family 4 (anion exchanger), member 1, adapter protein, solute carrier family 4 (anion exchanger), member 1, adaptor protein, Solute carrier family 4 anion exchanger member 1 adapter protein | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 22950 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction