Kanadaptin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-38315-25ul

Product Code. 18634376

Description

Kanadaptin Polyclonal specifically detects Kanadaptin in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Kanadaptin
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Accession No.: Q9BWU0
• Gene Symbols: SLC4A1AP
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: TWGMGEDAVEDDAEENPIVLEFQQEREAFYIKDPKKALQGFFDREGEELEYEFDEQGHSTWLCRVRLPVDDSTGKQLVAEAIHSGKK
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: FLJ10624, FLJ41004, HLC3, HLC-3, Human lung cancer oncogene 3 protein, kanadaptin, Kidney anion exchanger adapter protein, kidney anion exchanger adaptor protein, lung cancer oncogene 3, MGC120646, MGC120648, solute carrier family 4 (anion exchanger), member 1, adapter protein, solute carrier family 4 (anion exchanger), member 1, adaptor protein, Solute carrier family 4 anion exchanger member 1 adapter protein
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 22950
• Target Species: Human
• Isotype: IgG