missing translation for 'onlineSavingsMsg'
Learn More
Learn More
KA2/GRIK5/Glutamate Receptor KA2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£391.00
Specifications
| Antigen | KA2/GRIK5/Glutamate Receptor KA2 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
Description
KA2/GRIK5/Glutamate Receptor KA2 Polyclonal specifically detects KA2/GRIK5/Glutamate Receptor KA2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).Specifications
| KA2/GRIK5/Glutamate Receptor KA2 | |
| Unconjugated | |
| RUO | |
| EAA2, Excitatory amino acid receptor 2, glutamate receptor KA2, Glutamate receptor KA-2, glutamate receptor, ionotropic kainate 5, glutamate receptor, ionotropic, kainate 5, KA2GRIK2 | |
| GRIK5 | |
| IgG |
| Polyclonal | |
| Rabbit | |
| NP_002079 | |
| 2901 | |
| Synthetic peptide directed towards the middle region of human GRIK5. Peptide sequence EDGLYGAPEPNGSWTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFM. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title