missing translation for 'onlineSavingsMsg'
Learn More
Learn More
JWA Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
£231.00 - £470.00
Specifications
| Antigen | JWA |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18476990
|
Novus Biologicals
NBP1-84273-25ul |
25 μL |
£231.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18283367
|
Novus Biologicals
NBP1-84273 |
0.1 mL |
£470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
JWA Polyclonal specifically detects JWA in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| JWA | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 10550 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:PLLLMFIHASLRLRNLKNKLENKMEGIGLKRTPMGIVLDALEQQEEGINRLTDYISKVKE | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| ADP-ribosylation factor-like protein 6-interacting protein 5, ADP-ribosylation-like factor 6 interacting protein 5, Aip-5, ARL-6-interacting protein 5, Cytoskeleton-related vitamin A-responsive protein, Dermal papilla-derived protein 11, DERP11addicsin, Glutamate transporter EAAC1-interacting protein, glutamate transporter EEAC1-associated protein, GTRAP3-18aip-5, hp22, HSPC127, JM5, jmx, JWAcytoskeleton related vitamin A responsive protein, PRA1 domain family 3, PRA1 family protein 3, PRA2, PRAF3dermal papilla derived protein 11, Prenylated Rab acceptor protein 2, Protein JWa, putative MAPK activating protein PM27, Putative MAPK-activating protein PM27 | |
| ARL6IP5 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title