missing translation for 'onlineSavingsMsg'
Learn More
Learn More
JNK3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35745-100ul
This item is not returnable.
View return policy
Description
JNK3 Polyclonal antibody specifically detects JNK3 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| JNK3 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA | |
| c-Jun N-terminal kinase 3, EC 2.7.11, EC 2.7.11.24, JNK3 alpha protein kinase, JNK3A, JNK3FLJ12099, MAP kinase 10, MAP kinase p49 3F12, MAPK 10, MGC50974, mitogen-activated protein kinase 10, p493F12, p54bSAPK, PRKM10FLJ33785, stress activated protein kinase beta, Stress-activated protein kinase JNK3 | |
| A synthetic peptide corresponding to a sequence within amino acids 300-400 of human JNK3 (NP_620448.1).,, Sequence:, NRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMN | |
| 100 μL | |
| Immunology, Innate Immunity, Protein Kinase, Wnt Signaling Pathway | |
| 5602 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction