JNK/JIP3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-49593

Product Code. 18678718

Description

JNK/JIP3 Polyclonal antibody specifically detects JNK/JIP3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: JNK/JIP3
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: C-jun-amino-terminal kinase interacting protein 3, C-Jun-amino-terminal kinase-interacting protein 3, DKFZp762N1113, homolog of Drosophila Sunday driver 2, JIP-3, JIP3FLJ00027, JNK MAP kinase scaffold protein 3, JNK/SAPK-associated protein-1, JNK/stress-activated protein kinase-associated protein 1, JNK-interacting protein 3, JSAP1, KIAA1066SYD2, mitogen-activated protein kinase 8 interacting protein 3, Mitogen-activated protein kinase 8-interacting protein 3, syd
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: AGVNLSGWRPNEDDAGNGVKPAPGRDPLTCDREGDGEPKSAHTSPEKKKAKELPEMDATSSRVWILTSTLTTSKVVIIDANQPGTVVDQF
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 23162
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG