missing translation for 'onlineSavingsMsg'
Learn More
Learn More
JMJD8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | JMJD8 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
JMJD8 Polyclonal specifically detects JMJD8 in Mouse samples. It is validated for Western Blot.Specifications
| JMJD8 | |
| Polyclonal | |
| Rabbit | |
| NP_082377 | |
| 339123 | |
| The immunogen for this antibody is Jmjd8. Peptide sequence PAYSFGIAGAGSGVPFHWHGPGFSEVIYGRKRWFLYPPEKTPEFHPNKTT. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| jmjC domain-containing protein 8, C16orf20, jumonji domain containing 8, PP14397 | |
| JMJD8 | |
| IgG | |
| 30 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title