JMJD2D Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-47413-25ul

Product Code. 18608275

Description

JMJD2D Polyclonal specifically detects JMJD2D in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: JMJD2D
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin 1:10 - 1:20
• Gene Alias: EC 1.14.11, EC 1.14.11.-, FLJ10251, JHDM3D, JmjC domain-containing histone demethylation protein 3D, JMJD2Dlysine-specific demethylase 4D, jumonji domain containing 2D, Jumonji domain-containing protein 2D, lysine (K)-specific demethylase 4D, MGC141909
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: KDM4D
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LRQLPSHWARHSPWPMAARSGTRCHTLVCSSLPRRSAVSGTATQPRAAAVHSSKKPSSTPSSTPGPSAQIIHPSN
• Quantity: 25 μL
• Research Discipline: Transcription Factors and Regulators
• Gene ID (Entrez): 55693
• Target Species: Human
• Isotype: IgG

For Research Use Only