missing translation for 'onlineSavingsMsg'
Learn More
Learn More
JMJD2B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£145.00 - £417.00
Specifications
| Antigen | JMJD2B |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000, ELISA |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30230040
|
Novus Biologicals
NBP3-38192-20ul |
20 μL |
£145.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30227711
|
Novus Biologicals
NBP3-38192-100ul |
100 μL |
£417.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
JMJD2B Polyclonal antibody specifically detects JMJD2B in Human,Mouse samples. It is validated for ELISA,Western BlotSpecifications
| JMJD2B | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Chromatin Research, Epigenetics | |
| PBS (pH 7.3), 50% glycerol | |
| 23030 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:1000, ELISA | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse | |
| EC 1.14.11, FLJ44906, JHDM3B, JmjC domain-containing histone demethylation protein 3B, JMJD2BEC 1.14.11.-, jumonji domain containing 2B, Jumonji domain-containing protein 2B, KIAA0876lysine-specific demethylase 4B, lysine (K)-specific demethylase 4B | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-365 of human JMJD2B (NP_055830.1).,, Sequence:, RAVSLGQVVITKNRNGLYYRCRVIGAASQTCYEVNFDDGSYSDNLYPESITSRDCVQLGPPSEGELVELRWTDGNLYKAKFISSVTSHIYQVEFEDGSQLTVKRGDIFTLEEELP | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title