JMJD1B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-58143-25ul

Product Code. 18649927

Description

JMJD1B Polyclonal specifically detects JMJD1B in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: JMJD1B
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: C5orf7, EC 1.14.11, EC 1.14.11.-, JHDM2B, JmjC domain-containing histone demethylation protein 2B, JMJD1B, jumonji domain containing 1B, Jumonji domain-containing protein 1B, KIAA1082chromosome 5 open reading frame 7, lysine (K)-specific demethylase 3B, lysine-specific demethylase 3B, NET22,5qNCA, Nuclear protein 5qNCA
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 51780
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: KDM3B
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TLSSSPTEERPTVGPGQQDNPLLKTFSNVFGRHSGGFLSSPADFSQENKAPFEAVKRFSLDERSLACRQDSDSST
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

For Research Use Only