JIP2 Rabbit anti-Rat, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-09334-25UL

Product Code. 18314254

Description

JIP2 Polyclonal specifically detects JIP2 in Rat samples. It is validated for Western Blot.

Specifications

• Antigen: JIP2
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: C-Jun-amino-terminal kinase-interacting protein 2, homologous to mouse JIP-1, IB-2, IB2JIP2Mitogen-activated protein kinase 8-interacting protein 2, islet-brain 2, Islet-brain-2, JIP-2, JNK MAP kinase scaffold protein 2, JNK MAP kinase scaffold protein JIP2, JNK-interacting protein 2, mitogen-activated protein kinase 8 interacting protein 2, PRKM8 interacting protein-like, PRKM8IPL
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat JIP2 (XP_001055248). Peptide sequence SEPEPEPEPEPLHEPPRRPAFLPVGQDDTNSEYESGSESEPDLSEDADSP
• Quantity: 25 μg
• Research Discipline: Apoptosis
• Gene ID (Entrez): 23542
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Rat
• Form: Purified