missing translation for 'onlineSavingsMsg'
Learn More
Learn More
JIP2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-10078-100UL
This item is not returnable.
View return policy
Description
JIP2 Polyclonal specifically detects JIP2 in Human samples. It is validated for Western Blot.
Specifications
| JIP2 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| C-Jun-amino-terminal kinase-interacting protein 2, homologous to mouse JIP-1, IB-2, IB2JIP2Mitogen-activated protein kinase 8-interacting protein 2, islet-brain 2, Islet-brain-2, JIP-2, JNK MAP kinase scaffold protein 2, JNK MAP kinase scaffold protein JIP2, JNK-interacting protein 2, mitogen-activated protein kinase 8 interacting protein 2, PRKM8 interacting protein-like, PRKM8IPL | |
| The immunogen is a synthetic peptide directed towards the middle region of human JIP2 (NP_036456.1). Peptide sequence SEPEPPREPPRRPAFLPVGPDDTNSEYESGSESEPDLSEDADSPWLLSNL | |
| 100 μg | |
| Apoptosis | |
| 23542 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction