IYD Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-31786-25ul

Product Code. 18452832

Description

IYD Polyclonal specifically detects IYD in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: IYD
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Accession No.: Q6PHW0
• Gene Symbols: IYD
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ADRSMEKKKGEPRTRAEARPWVDEDLKDSSDLHQAEEDADEWQESEENVEHIPFSHNHYPEK
• Quantity: 25 μL
• Research Discipline: Cardiovascular Biology
• Gene ID (Entrez): 389434
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: C6orf71, DEHAL1chromosome 6 open reading frame 71, dJ422F24.1, iodotyrosine dehalogenase 1, iodotyrosine deiodinase, IYD-1, TDH4
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only