missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ITPR2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-10355-100UL
This item is not returnable.
View return policy
Description
ITPR2 Polyclonal specifically detects ITPR2 in Human samples. It is validated for Western Blot.
Specifications
| ITPR2 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| inositol 14,5-triphosphate receptor, type 2, inositol 14,5-trisphosphate receptor type 2, insP3R2, IP3 receptor, IP3 receptor isoform 2, IP3R 2, IP3R2, Type 2 inositol 14,5-trisphosphate receptor, Type 2 InsP3 receptor | |
| The immunogen is a synthetic peptide directed towards the N-terminal region of HUMAN ITPR2. Peptide sequence FRDCLFKVCPMNRYSAQKQYWKAKQAKQGNHTEAALLKKLQHAAELEQKQ | |
| 100 μg | |
| Neuroscience | |
| 3709 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction