ITPA Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-17266-25UL

Product Code. 18301366

Description

ITPA Polyclonal antibody specifically detects ITPA in Human samples. It is validated for Western Blot, Immunofluorescence

Specifications

• Antigen: ITPA
• Classification: Polyclonal
• Dilution: Western Blot 0.04 to 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
• Gene Alias: C20orf37, dJ794I6.3, EC 3.6.1, EC 3.6.1.19, HLC14-06-P, Inosine triphosphatase, inosine triphosphatase (nucleoside triphosphate pyrophosphatase), inosine triphosphatase-A, inosine triphosphate pyrophosphatase, inosine triphosphate pyrophosphohydrolase, ITPase, My049 protein, nucleoside triphosphate diphosphatase, Putative oncogene protein hlc14-06-p
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GNAKKLEEVVQILGDKFPCTLVAQKIDLPEYQGEPDEISIQKCQEAVRQVQGPVLVEDTCLCFNALGGLPGPYIKWFLEKLKPEGLHQL
• Quantity: 25 μg
• Research Discipline: Amino Acids Drugs and other small molecules, Endocrinology, Signal Transduction
• Gene ID (Entrez): 3704
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified