ITPA Antibody, Novus Biologicals™

Rabbit Monoclonal Antibody

Brand:  Novus Biologicals NBP3-33545-100ul

Product Code. 30232155

Description

ITPA Monoclonal antibody specifically detects ITPA in Human,Mouse samples. It is validated for ELISA,Western Blot

Specifications

• Antigen: ITPA
• Classification: Monoclonal
• Dilution: Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL
• Gene Alias: C20orf37, dJ794I6.3, EC 3.6.1, EC 3.6.1.19, HLC14-06-P, Inosine triphosphatase, inosine triphosphatase (nucleoside triphosphate pyrophosphatase), inosine triphosphatase-A, inosine triphosphate pyrophosphatase, inosine triphosphate pyrophosphohydrolase, ITPase, My049 protein, nucleoside triphosphate diphosphatase, Putative oncogene protein hlc14-06-p
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 70-150 of human ITPA (Q9BY32).,, Sequence:, VEDTCLCFNALGGLPGPYIKWFLEKLKPEGLHQLLAGFEDKSAYALCTFALSTGDPSQPVRLFRGRTSGRIVAPRGCQDFG
• Quantity: 100 μL
• Research Discipline: Amino Acids Drugs and other small molecules, Endocrinology, Signal Transduction
• Gene ID (Entrez): 3704
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Form: Purified