missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ITPA Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-33545-20ul
This item is not returnable.
View return policy
Description
ITPA Monoclonal antibody specifically detects ITPA in Human,Mouse samples. It is validated for ELISA,Western Blot
Specifications
| ITPA | |
| Monoclonal | |
| Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL | |
| C20orf37, dJ794I6.3, EC 3.6.1, EC 3.6.1.19, HLC14-06-P, Inosine triphosphatase, inosine triphosphatase (nucleoside triphosphate pyrophosphatase), inosine triphosphatase-A, inosine triphosphate pyrophosphatase, inosine triphosphate pyrophosphohydrolase, ITPase, My049 protein, nucleoside triphosphate diphosphatase, Putative oncogene protein hlc14-06-p | |
| A synthetic peptide corresponding to a sequence within amino acids 70-150 of human ITPA (Q9BY32).,, Sequence:, VEDTCLCFNALGGLPGPYIKWFLEKLKPEGLHQLLAGFEDKSAYALCTFALSTGDPSQPVRLFRGRTSGRIVAPRGCQDFG | |
| 20 μL | |
| Amino Acids Drugs and other small molecules, Endocrinology, Signal Transduction | |
| 3704 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction