ITIH1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-81783-25ul

Product Code. 18410151

Description

ITIH1 Polyclonal specifically detects ITIH1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ITIH1
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: H1P, IATIH, IGHEP1, inter-alpha (globulin) inhibitor H1, inter-alpha (globulin) inhibitor, H1 polypeptide, Inter-alpha-inhibitor heavy chain 1, Inter-alpha-trypsin inhibitor complex component III, inter-alpha-trypsin inhibitor heavy chain H1, ITI heavy chain H1, ITIH, ITI-HC1, MGC126415, Serum-derived hyaluronan-associated protein, SHAP
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 3697
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: ITIH1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:QPGDYFDLVLFGTRVQSWKGSLVQASEANLQAAQDFVRGFSLDEATNLNGGLLRGIEILNQVQESLPELSNHA
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only