missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ITF46 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £513.00
Specifications
| Antigen | ITF46 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18247951
|
Novus Biologicals
NBP2-55728 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18641698
|
Novus Biologicals
NBP2-55728-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ITF46 Polyclonal specifically detects ITF46 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| ITF46 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| C11orf2UPF0360, C11orf60, chromosome 11 open reading frame 60, FLJ21827, intraflagellar transport 46 homolog (Chlamydomonas), intraflagellar transport protein 46 homolog, intraflagellar transport protein IFT46 | |
| IFT46 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 56912 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LDEPSTKQSDPTVLSLWLTENSKQHNITQHMKVKSLEDAEKNPKAIDTWIESISELHRSKPPATVHYTRPMPDIDTLMQEWSPEF | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title