missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Isocitrate Dehydrogenase 1/IDH1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£211.00 - £410.00
Specifications
| Antigen | Isocitrate Dehydrogenase 1/IDH1 |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Simple Western 1:25, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18491512
|
Novus Biologicals
NBP2-34091-25ul |
25 μL |
£211.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18175733
|
Novus Biologicals
NBP2-34091 |
0.1 mL |
£410.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Isocitrate Dehydrogenase 1/IDH1 Polyclonal specifically detects Isocitrate Dehydrogenase 1/IDH1 in Human samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated.Specifications
| Isocitrate Dehydrogenase 1/IDH1 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| O75874 | |
| 3417 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: LAHRAKLDNNKELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQA | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.4 ug/ml, Simple Western 1:25, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Stem Cell Markers | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| Cytosolic NADP-isocitrate dehydrogenase, EC 1.1.1.42, IDCD, IDH, IDP, IDPC, isocitrate dehydrogenase [NADP] cytoplasmic, isocitrate dehydrogenase 1 (NADP+), soluble, NADP(+)-specific ICDH, NADP-dependent isocitrate dehydrogenase, cytosolic, NADP-dependent isocitrate dehydrogenase, peroxisomal, Oxalosuccinate decarboxylase, PICD | |
| IDH1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title