missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ISG20 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35464-20ul
This item is not returnable.
View return policy
Description
ISG20 Polyclonal antibody specifically detects ISG20 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| ISG20 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA | |
| CD25, Estrogen-regulated transcript 45 protein, HEM45EC 3.1.13.1, interferon stimulated exonuclease gene 20kDa, interferon stimulated gene (20kD), interferon-stimulated gene 20 kDa protein, Promyelocytic leukemia nuclear body-associated protein ISG20 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human ISG20 (NP_002192.2).,, Sequence:, MAGSREVVAMDCEMVGLGPHRESGLARCSLVNVHGAVLYDKFIRPEGEITDYRTRVSGVTPQHMVGATPF | |
| 20 μL | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 3669 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction