ISCU Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-38420

Product Code. 18165929

Description

ISCU Polyclonal specifically detects ISCU in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ISCU
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: Q9H1K1
• Gene Symbols: ISCU
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: TFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPK
• Quantity: 0.1 mL
• Research Discipline: Proteases & Other Enzymes
• Gene ID (Entrez): 23479
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: 2310020H20Rik, HML, hnifU, iron-sulfur cluster assembly enzyme ISCU, mitochondrial, iron-sulfur cluster scaffold homolog (E. coli), IscU, IscU iron-sulfur cluster scaffold homolog, IscU iron-sulfur cluster scaffold homolog (E. coli), ISU2, MGC74517, NIFU, NifU-like N-terminal domain containing, NifU-like N-terminal domain-containing protein, NifU-like protein, NIFUN
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.