missing translation for 'onlineSavingsMsg'
Learn More
Learn More
IRX3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£359.00
Specifications
| Antigen | IRX3 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml, Immunohistochemistry |
| Applications | Western Blot, Immunohistochemistry |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
IRX3 Polyclonal specifically detects IRX3 in Human samples. It is validated for Western Blot, Immunohistochemistry.Specifications
| IRX3 | |
| Western Blot, Immunohistochemistry | |
| Unconjugated | |
| Rabbit | |
| Human | |
| Homeodomain protein IRXB1, iroquois homeobox 3, Iroquois homeobox protein 3, iroquois-class homeodomain protein IRX-1, iroquois-class homeodomain protein IRX-3, IRX-1, IRXB1FLJ99187 | |
| The immunogen is a synthetic peptide directed towards the C terminal region of human IRX3 (NP_077312). Peptide sequence SPAAAAAAAHRLVSAPLGKFPAWTNRPFPGPPPGPRLHPLSLLGSAPPHL | |
| Affinity purified |
| Western Blot 1.0 ug/ml, Immunohistochemistry | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 79191 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title