IRGC Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-14129

Product Code. 18405411

Description

IRGC Polyclonal antibody specifically detects IRGC in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: IRGC
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Alias: CINEMA, EC 3.6.5, EC 3.6.5.-, Iigp5, Immunity-related GTPase cinema 1, immunity-related GTPase family, cinema, immunity-related GTPase family, cinema 1, interferon inducible GTPase 5, interferon-inducible GTPase 5, IRGC1, R30953_1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: YPHPQFPDVTLWDLPGAGSPGCPADKYLKQVDFSRYDFFLLVSPRRCGAVETRLAAEILCQGKKFYFVRTKVDEDLAATRTQRPSGFREAAVLQEIRDHC
• Quantity: 0.1 mL
• Research Discipline: Innate Immunity
• Gene ID (Entrez): 56269
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified