missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
IRGC Polyclonal antibody specifically detects IRGC in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigen | IRGC |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Formulation | PBS (pH 7.2) and 40% Glycerol |
| Gene Alias | CINEMA, EC 3.6.5, EC 3.6.5.-, Iigp5, Immunity-related GTPase cinema 1, immunity-related GTPase family, cinema, immunity-related GTPase family, cinema 1, interferon inducible GTPase 5, interferon-inducible GTPase 5, IRGC1, R30953_1 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: YPHPQFPDVTLWDLPGAGSPGCPADKYLKQVDFSRYDFFLLVSPRRCGAVETRLAAEILCQGKKFYFVRTKVDEDLAATRTQRPSGFREAAVLQEIRDHC |
| Purification Method | Immunogen affinity purified |
| Show More |
Product Title
En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.
Vous avez repéré une opportunité d'amélioration ?