IRGC Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18478041	Novus Biologicals NBP2-32512-25ul	25 μL
18119084	Novus Biologicals NBP2-32512	0.1 mL

Description

IRGC Polyclonal specifically detects IRGC in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: IRGC
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 56269
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ALLIHSLRGYHRSFGLDDDSLAKLAEQVGKQAGDLRSVIRSPLANEVSPETVLRLYSQSSDGAMRVARAFERGIPVFGTLVA
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: CINEMA, EC 3.6.5, EC 3.6.5.-, Iigp5, Immunity-related GTPase cinema 1, immunity-related GTPase family, cinema, immunity-related GTPase family, cinema 1, interferon inducible GTPase 5, interferon-inducible GTPase 5, IRGC1, R30953_1
• Gene Symbols: IRGC
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only