IRF4, Mouse anti-Human, Clone: 3C4, Abnova™

Mouse Monoclonal Antibody

Brand:  Abnova H00003662-M10.100ug

Product Code. 16100245

Beschreibung

Sequence: LCNDRPNKLERDQTCKLFDTQQFLSELQAFAHHGRSLPRFQVTLCFGEEFPDPQRQRKLITAHVEPLLARQLYYFAQQNSGHFLRGYDLPEHISNPEDYHRSIRHSSIQE

Spezifikation

• Antigen: IRF4
• Classification: Monoclonal
• Conjugate: Unconjugated
• Gene: interferon regulatory factor 4
• Gene Alias: LSIRF/MUM1
• Host Species: Mouse
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Western Blot
• Clone: 3C4
• Formulation: In 1x PBS, pH 7.4
• Gene Accession No.: NM_002460
• Gene Symbols: IRF4
• Immunogen: IRF4 (NP_002451, 342 a.a. ∼ 451 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Gene ID (Entrez): 3662
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ