missing translation for 'onlineSavingsMsg'
Learn More
Learn More
IRF2BP2 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94463-0.1ml
This item is not returnable.
View return policy
Description
IRF2BP2 Polyclonal antibody specifically detects IRF2BP2 in Human, Mouse samples. It is validated for Western Blot
Specifications
| IRF2BP2 | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000 | |
| interferon regulatory factor 2 binding protein 2, IRF-2-binding protein 2 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 475-545 of human IRF2BP2 (Q7Z5L9). GGQGAGNTGGLEPVHPASLPDSSLATSAPLCCTLCHERLEDTHFVQCPSVPSHKFCFPCSRQSIKQQGASG | |
| 0.1 mL | |
| Primary | |
| Human, Mouse | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 359948 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction