missing translation for 'onlineSavingsMsg'
Learn More
Learn More
IQCD Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | IQCD |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
IQCD Polyclonal specifically detects IQCD in Human samples. It is validated for Western Blot.Specifications
| IQCD | |
| Polyclonal | |
| Rabbit | |
| Protein Kinase | |
| 115811 | |
| Synthetic peptides corresponding to IQCD (IQ motif containing D) The peptide sequence was selected from the middle region of IQCD. Peptide sequence CLKEKERQLQEQKEAEEEGWLRDRLLSIELQKSSLSPLMQQIKDSTKNVL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 4933433C09Rik, IQ domain-containing protein D, IQ motif containing D | |
| IQCD | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title