IPPK Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18401281	Novus Biologicals NBP1-86712-25ul	25 μL
18259526	Novus Biologicals NBP1-86712	0.1 mL

Description

IPPK Polyclonal specifically detects IPPK in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: IPPK
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human, Mouse, Rat
• Gene Alias: bA476B13.1, bA476B13.1 (novel protein), C9orf12, chromosome 9 open reading frame 12, EC 2.7.1.158, FLJ13163, inositol 13,45,6-pentakisphosphate 2-kinase, Inositol-13,45,6-pentakisphosphate 2-kinase, inositol-pentakisphosphate 2-kinase, Ins(13,45,6)P5 2-kinase, InsP5 2-kinase, INSP5K2, IP5K, IPK1, IPK1 homolog, KIAA0699
• Gene Symbols: IPPK
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of human IPPK antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:500-1:1000
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 64768
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:GCLLYKTLQVQMLDLLDIEGLYPLYNRVERYLEEFPEERKTLQIDGPYDEAFYQKLLDLSTEDDGTVAFALTKVQQYR
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only