missing translation for 'onlineSavingsMsg'
Learn More

IPPK Antibody, Novus Biologicals™

Product Code. 18401281 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Quantity unitSize
18401281 25 μL 25µL
18259526 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 18401281 Leverantör Novus Biologicals Leverantörsnummer NBP18671225ul

Please to purchase this item. Need a web account? Register with us today!

Denna artikel kan inte returneras. Se returpolicy

Rabbit Polyclonal Antibody

IPPK Polyclonal specifically detects IPPK in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifikationer

Antigen IPPK
Applications Immunocytochemistry, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:500-1:1000
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias bA476B13.1, bA476B13.1 (novel protein), C9orf12, chromosome 9 open reading frame 12, EC 2.7.1.158, FLJ13163, inositol 13,45,6-pentakisphosphate 2-kinase, Inositol-13,45,6-pentakisphosphate 2-kinase, inositol-pentakisphosphate 2-kinase, Ins(13,45,6)P5 2-kinase, InsP5 2-kinase, INSP5K2, IP5K, IPK1, IPK1 homolog, KIAA0699
Gene Symbols IPPK
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:GCLLYKTLQVQMLDLLDIEGLYPLYNRVERYLEEFPEERKTLQIDGPYDEAFYQKLLDLSTEDDGTVAFALTKVQQYR
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 64768
Test Specificity Specificity of human IPPK antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse, Rat
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Visa mer Visa mindre

For Research Use Only

Produkttitel
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.