missing translation for 'onlineSavingsMsg'
Learn More
Learn More
IP6K3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-17386-100UL
This item is not returnable.
View return policy
Description
IP6K3 Polyclonal antibody specifically detects IP6K3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| IP6K3 | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| IHPK3ATP:1D-myo-inositol-hexakisphosphate phosphotransferase, inositol hexakisphosphate kinase 3, Inositol hexaphosphate kinase 3EC 2.7.4.21, InsP6 kinase 3, INSP6K3MGC102928 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: LVIYDGQEPPERAPGSPHPHEAPQAAHGSSPGGLTKVDIRMID | |
| 100 μg | |
| Apoptosis | |
| 117283 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction