missing translation for 'onlineSavingsMsg'
Learn More

INTS6 Antibody, Novus Biologicals™

Product Code. 18403482 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18403482 25 μL 25µL
18241287 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18403482 Supplier Novus Biologicals Supplier No. NBP18802925ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

INTS6 Polyclonal specifically detects INTS6 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Especificaciones

Antigen INTS6
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:250 - 1:500, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias DBI1, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 26, DICE1DBI-1DDX26ADDX26DEAD box protein, DKFZp434B105, HDB, INT6, integrator complex subunit 6, Notchl2, Protein DDX26, Protein deleted in cancer 1, RNA helicase HDB
Gene Symbols INTS6
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KYELEPSPLTQFILERKSPQTCWQVYVSNSAKYSELGHPFGYLKASTALNCVNLFVMPYNYPVLLPLLDDLFKVHKAKPTLKWRQSFESYLKTMPPYYLGPLKKAVRMMGAPNLIADSMEYGLSYSVISYLKKLSQQAKIES
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cancer, Growth and Development, Neuronal Cell Markers, Tumor Suppressors
Primary or Secondary Primary
Gene ID (Entrez) 26512
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Mostrar más Mostrar menos

For Research Use Only

Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.