Intelectin-1/Omentin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-68855

Product Code. 18663478

Description

Intelectin-1/Omentin Polyclonal antibody specifically detects Intelectin-1/Omentin in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: Intelectin-1/Omentin
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Alias: Endothelial lectin HL-1, FLJ20022, Galactofuranose-binding lectin, hIntL, HL-1, intelectin 1 (galactofuranose binding), intelectin-1, INTLHL1, ITLNITLN-1, LFRIntestinal lactoferrin receptor, omentin
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DGNWANYNTFGSAEAATSDDYKNPGYYDIQAKDLGIWHVPNKSPMQHWRNS
• Quantity: 100 μg
• Research Discipline: Cardiovascular Biology, metabolism
• Gene ID (Entrez): 55600
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified