missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Intelectin-1/Omentin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-68855-25ul
This item is not returnable.
View return policy
Description
Intelectin-1/Omentin Polyclonal antibody specifically detects Intelectin-1/Omentin in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| Intelectin-1/Omentin | |
| Polyclonal | |
| Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Endothelial lectin HL-1, FLJ20022, Galactofuranose-binding lectin, hIntL, HL-1, intelectin 1 (galactofuranose binding), intelectin-1, INTLHL1, ITLNITLN-1, LFRIntestinal lactoferrin receptor, omentin | |
| This antibody was developed against a recombinant protein corresponding to amino acids: DGNWANYNTFGSAEAATSDDYKNPGYYDIQAKDLGIWHVPNKSPMQHWRNS | |
| 25 μL | |
| Cardiovascular Biology, metabolism | |
| 55600 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction