missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Integrin beta 8 Antibody (CL7290), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals NBP2-76480-25ul
This item is not returnable.
View return policy
Description
Integrin beta 8 Monoclonal specifically detects Integrin beta 8 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Specifications
| Integrin beta 8 | |
| Monoclonal | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide | |
| ITGB8 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: AQHCVNSKGQVCSGRGTCVCGRCECTDPRSIGRFCEHCPTCYTACKENWNCMQCLHPHNLSQAILDQCKTSCALMEQQHY | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| IgG1 |
| ELISA, Immunohistochemistry, Immunofluorescence | |
| CL7290 | |
| Western Blot 1 μg/mL, Immunocytochemistry/Immunofluorescence 2-10 μg/mL | |
| integrin beta-8, integrin, beta 8 | |
| Mouse | |
| 25 μL | |
| 3696 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction