missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Integrin alpha 6/CD49f Antibody, Novus Biologicals™

Integrin alpha 6/CD49f Antibody, Novus Biologicals™

Product Code. 18402901 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
Unit Size:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18402901 25 μL 25µL
18709593 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18402901 Supplier Novus Biologicals Supplier No. NBP18574725ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Integrin alpha 6/CD49f Polyclonal antibody specifically detects Integrin alpha 6/CD49f in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin).
TRUSTED_SUSTAINABILITY

Specifications

Antigen Integrin alpha 6/CD49f
Applications Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/ml, Simple Western 1:50, Immunohistochemistry 1:200 - 1:500, Immunoprecipitation Reported in scientific literature (PMID: 23888051)., Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. P23229
Gene Alias CD49 antigen-like family member F, CD49f, CD49f antigen, DKFZp686J01244, FLJ18737, integrin alpha-6, integrin alpha6B, integrin, alpha 6, ITGA6B, VLA-6
Gene Symbols ITGA6
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:APYDDLGKVFIYHGSANGINTKPTQVLKGISPYFGYSIAGNMDLDRNSYPDVAVGSLSDSVTIFRSRPVINIQKTITVTPNRIDLRQKTACGAPSGICLQVKSCFEYTANPAGYNPSISIVGTLEAEKERRKSGLSS
Molecular Weight of Antigen 127 kDa
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 3655
Test Specificity Specificity of human Integrin alpha 6/CD49f antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse, Rat
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.