missing translation for 'onlineSavingsMsg'
Learn More

Integrin alpha 4/CD49d Rabbit anti-Human, Mouse, Rat, Clone: 8M8C2, Novus Biologicals™

Product Code. 18377842
Change view
Click to view available options
Quantity:
100 μg
20 μg
Unit Size:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18377842 100 μg 100µL
18098225 20 μg 20µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18377842 Supplier Novus Biologicals Supplier No. NBP316322100UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Monoclonal Antibody

Integrin alpha 4/CD49d Monoclonal antibody specifically detects Integrin alpha 4/CD49d in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen Integrin alpha 4/CD49d
Applications Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone 8M8C2
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunoprecipitation 1:50 - 1:200, Immunohistochemistry-Paraffin
Formulation PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene Alias 269C wild type, CD49 antigen-like family member D, CD49d, CD49d antigen, CD49Dantigen CD49D, alpha-4 subunit of VLA-4 receptor, IA4, integrin alpha 4, integrin alpha-4, integrin alpha-4 subunit, Integrin alpha-IV, integrin, alpha 4 (antigen CD49D, alpha 4 subunit of VLA-4 receptor), MGC90518, very late activation protein 4 receptor, alpha 4 subunit, VLA-4 subunit alpha
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 933-1032 of human Integrin alpha 4/CD49d (P13612). ALKFEIRATGFPEPNPRVIELNKDENVAHVLLEGLHHQRPKRYFTIVIISSSLLLGLIVLLLISYVMWKAGFFKRQYKSILQEENRRDSWSYINSKSNDD
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Cancer, Cell Biology, Cellular Markers, Cytokine Research, Growth and Development, Lysosome Markers, Mast Cell Markers, Membrane Trafficking and Chaperones, Microautophagy, Neuronal Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 3676
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.