missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Integrin alpha 3B Antibody (54B3), Alexa Fluor™ 405, Novus Biologicals™
Shop All Bio Techne ProductsDescription
Integrin alpha 3B Monoclonal antibody specifically detects Integrin alpha 3B in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Frozen)
Specifications
Specifications
| Antigen | Integrin alpha 3B |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry (Frozen) |
| Classification | Monoclonal |
| Clone | 54B3 |
| Conjugate | Alexa Fluor 405 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | AA407068, CD49C, GAPB3, integrin alpha 3 |
| Host Species | Mouse |
| Immunogen | Derived by fusion of SP2/0 Mouse myeloma cells with spleen cells from a BALB/c Mouse immunized with a synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of Integrin alpha 3Bincluding an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to keyhole limpet hemocyanin. |
| Purification Method | Protein A or G purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?