missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
Integrin alpha 2b/CD41 Polyclonal specifically detects Integrin alpha 2b/CD41 in Human samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
Specifications
| Antigen | Integrin alpha 2b/CD41 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 0.04 - 0.4 ug/mL, Simple Western 1:25, Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000 |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Gene Alias | CD41, CD41 antigen, CD41BHPA3, GP2Bintegrin alpha-IIb, GPalpha IIb, GPIIb, GTA, integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigenCD41), integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigenCD41B), ITGAB, platelet fibrinogen receptor, alpha subunit, Platelet membrane glycoprotein IIb, platelet-specific antigen BAK |
| Gene Symbols | ITGA2B |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:GATGHNIPQKLSLNAELQLDRQKPRQGRRVLLLGSQQAGTTLNLDLGGKHSPICHTTMAFLRDEADFRDKLSPIVLSLNVSLPPTEAGMAPAV |
| Show More |
For Research Use Only
Título del producto
Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.
¿Detecta una oportunidad de mejora?