missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Integrin alpha 2/CD49b Rabbit anti-Human, Mouse, Rat, Clone: 7O9H6, Novus Biologicals™
Rabbit Monoclonal Antibody
£167.00 - £413.00
Specifications
| Antigen | Integrin alpha 2/CD49b |
|---|---|
| Clone | 7O9H6 |
| Dilution | Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunoprecipitation 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200, Knockout Validated |
| Applications | Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin), KnockDown |
| Classification | Monoclonal |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18362992
|
Novus Biologicals
NBP3-15644-20UL |
20 μg |
£167.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18328272
|
Novus Biologicals
NBP3-15644-100UL |
100 μg |
£413.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Integrin alpha 2/CD49b Monoclonal antibody specifically detects Integrin alpha 2/CD49b in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin), KnockDownSpecifications
| Integrin alpha 2/CD49b | |
| Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunoprecipitation 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200, Knockout Validated | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| alpha-2 subunit, CD49b antigen, integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor), VLA 2 | |
| A synthetic peptide corresponding to a sequence within amino acids 1082-1181 of human Integrin alpha 2/CD49b (P17301). GTFASSTFQTVQLTAAAEINTYNPEIYVIEDNTVTIPLMIMKPDEKAEVPTGVIIGSIIAGILLLLALVAILWKLGFFKRKYEKMTKNPDEIDETTELSS | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| 7O9H6 | |
| Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin), KnockDown | |
| Unconjugated | |
| Rabbit | |
| Cellular Markers, Innate Immunity, Signal Transduction | |
| PBS, 0.05% BSA, 50% glycerol, pH7.3 | |
| 3673 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title