Integrin alpha 2/CD49b Antibody (CL7318), Novus Biologicals™

Mouse Monoclonal Antibody

Brand:  Novus Biologicals NBP2-76483-25ul

Product Code. 18652171

Description

Integrin alpha 2/CD49b Monoclonal specifically detects Integrin alpha 2/CD49b in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Integrin alpha 2/CD49b
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide
• Gene Symbols: ITGA2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ALEAYSETAKVFSIPFHKDCGEDGLCISDLVLDVRQIPAAQEQPFIVSNQNKRLTFSVTLKNKRESAYNTGIVVDFSENLFFASFSLPV
• Quantity: 25 μL
• Research Discipline: Cellular Markers, Innate Immunity, Signal Transduction
• Gene ID (Entrez): 3673.0
• Target Species: Human
• Form: Purified

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Clone: CL7318
• Dilution: Western Blot 1 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: alpha-2 subunit, CD49b antigen, integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor), VLA 2
• Host Species: Mouse
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG1