missing translation for 'onlineSavingsMsg'
Learn More
Learn More
INT3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £513.00
Specifications
| Antigen | INT3 |
|---|---|
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18298061
|
Novus Biologicals
NBP2-57633 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18645636
|
Novus Biologicals
NBP2-57633-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
INT3 Polyclonal specifically detects INT3 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| INT3 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 65123 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LEHLDNLRLNLTNTKQNFFSQTPILQALQHVQASCDEAHKMKFSDLFSLAEEYEDSSTKPPKSRRKAALSSPRSRKNATQP | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| C1orf193, C1orf60, chromosome 1 open reading frame 60, DKFZp686E1950, DKFZp686O20115, DKFZp781I1253, FLJ21919, FLJ44849, INT3, integrator complex subunit 3, RP11-216N14.4, Sensor of single-strand DNA complex subunit A, sensor of ssDNA A, Sensor of ssDNA subunit A, SOSS complex subunit A, SOSS-A | |
| INTS3 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title