missing translation for 'onlineSavingsMsg'
Learn More

INT2 Antibody, Novus Biologicals™

Product Code. 18421161 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25ul
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18421161 25ul 25µL
18035569 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18421161 Supplier Novus Biologicals Supplier No. NBP21412525ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

INT2 Polyclonal specifically detects INT2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen INT2
Applications Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias Int2, integrator complex subunit 2, KIAA1287INT2
Gene Symbols INTS2
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the amino acids: ICLPTEEEKANGVNPDSLLRNVQSVITTSAPNKGMEEGEDNLLCNLREVQCLICCLLHQMYIADPNIAKLVHFQGYPCELL
Purification Method Affinity Purified
Quantity 25ul
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 57508
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Visa mer Visa mindre

For Research Use Only

Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.